Novus Biologicals
Manufacturer Code:NBP155161
Catalog # NBP155161
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FNTA(farnesyltransferase CAAX box alpha) The peptide sequence was selected from the N terminal of FNTA. Peptide sequence MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CAAX farnesyltransferase subunit alpha; CAAX farnesyltransferase subunit alpha EC 2.5.1.58 EC 2.5.1.59 farnesyl-protein transferase alpha-subunit farnesyltransferase CAAX box alpha FPTA FTase-alpha GGTase-I-alpha MGC99680 PGGT1A protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha protein prenyltransferase alpha subunit repeat containing 2 PTAR2 Ras proteins prenyltransferase subunit alpha type I protein geranyl-geranyltransferase alpha subunit Type I protein geranyl-geranyltransferase subunit alpha; farnesyl-protein transferase alpha-subunit; FTase-alpha; GGTase-I-alpha; Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; protein prenyltransferase alpha subunit repeat containing 2; Ras proteins prenyltransferase subunit alpha; type I protein geranyl-geranyltransferase alpha subunit; Type I protein geranyl-geranyltransferase subunit alpha
Gene Aliases: FNTA; FPTA; PGGT1A; PTAR2
UniProt ID: (Human) P49354
Entrez Gene ID: (Human) 2339
Molecular Function:
acyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.