Novus Biologicals
Manufacturer Code:NBP15973120UL
Catalog # NBP1597320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FMO5(flavin containing monooxygenase 5) The peptide sequence was selected from the middle region of FMO5. Peptide sequence NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Baeyer-Villiger monooxygenase 1; Dimethylaniline monooxygenase [N-oxide-forming] 5; dimethylaniline monooxygenase [N-oxide-forming] 5 Dimethylaniline oxidase 5 EC 1.14.13.8 flavin containing monooxygenase 5 FMO 5 Hepatic flavin-containing monooxygenase 5; Dimethylaniline oxidase 5; Flavin-containing monooxygenase 5; FMO 5; hBVMO1; hepatic flavin-containing monooxygenase 5; NAPDH oxidase
Gene Aliases: FMO5
UniProt ID: (Human) P49326
Entrez Gene ID: (Human) 2330
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.