Novus Biologicals
Manufacturer Code:NBP187911
Catalog # NBP187911
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LHLSFLQNAAKLYATVYCIPFAEEDLSADALLNILSEVKIQEFKPSNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEAT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: E1-L2; E1-L2 FLJ10808 FLJ23367 Monocyte protein 4 MOP4 MOP-4 UBA6 ubiquitin-activating enzyme E1 UBE1L2 Ubiquitin-activating enzyme 6 ubiquitin-activating enzyme E1-like 2 Ubiquitin-activating enzyme E1-like protein 2 ubiquitin-like modifier activating enzyme 6 ubiquitin-like modifier-activating enzyme 6; Monocyte protein 4; MOP-4; UBA6, ubiquitin-activating enzyme E1; Ubiquitin-activating enzyme 6; ubiquitin-activating enzyme E1-like 2; Ubiquitin-activating enzyme E1-like protein 2; ubiquitin-like modifier activating enzyme 6; Ubiquitin-like modifier-activating enzyme 6
Gene Aliases: E1-L2; MOP-4; MOP4; UBA6; UBE1L2
UniProt ID: (Human) A0AVT1
Entrez Gene ID: (Human) 55236
Molecular Function:
ligase
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.