Novus Biologicals
Manufacturer Code:NBP184751
Catalog # NBP184751
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRGYTSLGSRENTVRNPALKCLSPGGHPTYRPAYLLENEE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.7 FAD1 FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae) Fad1 flavin adenine dinucleotide synthetase homolog (yeast) FAD-synthetase Flavin adenine dinucleotide synthase flavin adenine dinucleotide synthetase flavin adenine dinucleotide synthetase homolog MGC31803 MGC40255 PP591; FAD pyrophosphorylase; FAD synthase; FAD synthase region; FAD-synthetase; Fad1, flavin adenine dinucleotide synthetase, homolog; Flavin adenine dinucleotide synthase; FMN adenylyltransferase; Molybdenum cofactor biosynthesis protein-like region
Gene Aliases: FAD1; FADS; FLAD1; LSMFLAD; PP591
UniProt ID: (Human) Q8NFF5
Entrez Gene ID: (Human) 80308
Molecular Function: nucleotidyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.