Novus Biologicals
Manufacturer Code:NBP184676
Catalog # NBP184676
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 51 kDa FK506-binding protein; 51 kDa FKBP; 51 kDa FKBP 54 kDa progesterone receptor-associated immunophilin AIG651 kDa FK506-binding protein Androgen-regulated protein 6 FF1 antigen FK506 binding protein 5 FK506-binding protein 5 FKBP-5 FKBP-51 FKBP51PPIase FKBP5 FKBP54EC 5.2.1.8 HSP90-binding immunophilin MGC111006 p54 P5451 kDa FK506-binding protein 5 peptidylprolyl cis-trans isomerase peptidyl-prolyl cis-trans isomerase FKBP5 PPIase Ptg-10 rotamase T-cell FK506-binding protein; 54 kDa progesterone receptor-associated immunophilin; Androgen-regulated protein 6; FF1 antigen; FK506-binding protein 5; FKBP-5; FKBP-51; FKBP54; HSP90-binding immunophilin; p54; Peptidyl-prolyl cis-trans isomerase FKBP5; peptidylprolyl cis-trans isomerase; PPIase FKBP5; Rotamase; T-cell FK506-binding protein
Gene Aliases: AIG6; FKBP5; FKBP51; FKBP54; P54; PPIase; Ptg-10
UniProt ID: (Human) Q13451
Entrez Gene ID: (Human) 2289
Molecular Function:
calcium-binding protein
chaperone
isomerase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.