Novus Biologicals
Manufacturer Code:NBP189213
Catalog # NBP189213
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHTDTK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acidic fibroblast growth factor; aFGF; AFGF alpha ECGF ECGFB ECGF-betaAcidic fibroblast growth factor endothelial cell growth factor beta FGFABeta-endothelial cell growth factor FGF-alpha fibroblast growth factor 1 (acidic) GLIO703 HBGF1 HBGF-1 heparin-binding growth factor 1; beta-endothelial cell growth factor; ECGF; Endothelial cell growth factor; endothelial cell growth factor, alpha; endothelial cell growth factor, beta; FGF-1; Fibroblast growth factor 1; fibroblast growth factor 1 (acidic); HBGF-1; Heparin-binding growth factor 1
Gene Aliases: AFGF; ECGF; ECGF-beta; ECGFA; ECGFB; FGF-1; FGF-alpha; FGF1; FGFA; GLIO703; HBGF-1; HBGF1
UniProt ID: (Human) P05230
Entrez Gene ID: (Human) 2246
Molecular Function: growth factor signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.