Novus Biologicals
Manufacturer Code:NBP18050320UL
Catalog # NBP18050320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Rat |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human Fgf3. Peptide sequence KGRPRRGFKTRRTQKSSLFLPRVLGHKDHEMVRLLQSGQPQAPGEGSQPR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FGF-3; Fibroblast growth factor 3; fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog); fibroblast growth factor 3 fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog) HBGF-3 mouse oncogene INT2; HBGF-3; Heparin-binding growth factor 3; INT-2 proto-oncogene protein; murine mammary tumor virus integration site 2, mouse; oncogene INT2; Proto-oncogene Int-2; V-INT2 murine mammary tumor virus integration site oncogene homolog
Gene Aliases: FGF3; HBGF-3; INT2
UniProt ID: (Human) P11487
Entrez Gene ID: (Human) 2248
Molecular Function:
growth factor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.