Novus Biologicals
Manufacturer Code:NBP159303
Catalog # NBP159303
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FGF13(fibroblast growth factor 13) The peptide sequence was selected from the middle region of FGF13. Peptide sequence TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FGF-13; FGF-13 FGF2Fibroblast growth factor homologous factor 2 FHF2FHF-2 fibroblast growth factor 13; FHF-2; Fibroblast growth factor 13; Fibroblast growth factor homologous factor 2
Gene Aliases: FGF-13; FGF13; FGF2; FHF-2; FHF2
UniProt ID: (Human) Q92913
Entrez Gene ID: (Human) 2258
Molecular Function:
growth factor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.