Novus Biologicals
Manufacturer Code:NBP189739
Catalog # NBP189739
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FRVVPQRLPGADQEISICTLIWPTIPGEISWDV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Free fatty acid receptor 4; G protein-coupled receptor 120 G protein-coupled receptor 129 G protein-coupled receptor PGR4 GPR120 GPR129 G-protein coupled receptor 120 G-protein coupled receptor 129 G-protein coupled receptor GT01 G-protein coupled receptor PGR4 G-protein-coupled receptor GT01 GT01 MGC119984 omega-3 fatty acid receptor 1 PGR4DKFZp686F0824; G-protein coupled receptor 120; G-protein coupled receptor 129; G-protein coupled receptor GT01; G-protein coupled receptor PGR4; Omega-3 fatty acid receptor 1
Gene Aliases: BMIQ10; FFAR4; GPR120; GPR129; GT01; O3FAR1; PGR4
UniProt ID: (Human) Q5NUL3
Entrez Gene ID: (Human) 338557
Molecular Function:
G-protein coupled receptor
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.