Novus Biologicals
Manufacturer Code:NBP159061
Catalog # NBP159061
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FCGRT(Fc fragment of IgG receptor transporter alpha) The peptide sequence was selected from the N terminal of FCGRT (NP_004098). Peptide sequence GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha-chain Fc fragment of IgG receptor transporter alpha FcRn FcRn alpha chain FCRNimmunoglobulin receptor intestinal heavy chain IgG Fc fragment receptor transporter alpha chain IgG receptor FcRn large subunit p51 major histocompatibility complex class I-like Fc receptor Neonatal Fc receptor neonatal Fc-receptor for Ig; Fc fragment of IgG, receptor, transporter, alpha; FcRn; FcRn alpha chain; heavy chain of the major histocompatibility complex class I-like Fc receptor; IgG Fc fragment receptor transporter alpha chain; IgG receptor FcRn large subunit p51; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; Neonatal Fc receptor; neonatal Fc-receptor for Ig; transmembrane alpha chain of the neonatal receptor
Gene Aliases: alpha-chain; FCGRT; FCRN
UniProt ID: (Human) P55899
Entrez Gene ID: (Human) 2217
Molecular Function: cytokine receptor defense/immunity protein immunoglobulin receptor superfamily major histocompatibility complex antigen receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.