Novus Biologicals
Manufacturer Code:NBP155066
Catalog # NBP155066
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
ChIP assay (ChIP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FBXO11(F-box protein 11) The peptide sequence was selected from the middle region of FBXO11 (NP_079409). Peptide sequence HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: F-box only protein 11; F-box only protein 11 F-box protein 11 FBX11MGC44383 FLJ12673 PRMT9VIT1protein arginine N-methyltransferase 9 ubiquitin protein ligase E3 component n-recognin 6 UBR6 VIT-1 Vitiligo-associated protein 1 vitiligo-associated protein VIT-1; Protein arginine N-methyltransferase 9; ubiquitin protein ligase E3 component n-recognin 6; VIT-1; Vitiligo-associated protein 1; vitiligo-associated protein VIT-1
Gene Aliases: FBX11; FBXO11; PRMT9; UBR6; UG063H01; VIT1
UniProt ID: (Human) Q86XK2
Entrez Gene ID: (Human) 80204
Molecular Function:
ligase
ubiquitin-protein ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.