Novus Biologicals
Manufacturer Code:NBP155293
Catalog # NBP155293
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FBP1(fructose-16-bisphosphatase 1) The peptide sequence was selected from the N terminal of FBP1. Peptide sequence YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D-fructose-1,6-bisphosphate 1-phosphohydrolase 1; D-fructose-16-bisphosphate 1-phosphohydrolase 1 EC 3.1.3 EC 3.1.3.11 FBP FBPase 1 fructose-16-bisphosphatase 1 fructose-bisphosphatase 1 growth-inhibiting protein 17; FBPase 1; Fructose-1,6-bisphosphatase 1; growth-inhibiting protein 17; Liver FBPase
Gene Aliases: FBP; FBP1
UniProt ID: (Human) P09467
Entrez Gene ID: (Human) 2203
Molecular Function:
carbohydrate phosphatase
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.