Novus Biologicals
Manufacturer Code:NBP156453
Catalog # NBP156453
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FBP2(fructose-16-bisphosphatase 2) The peptide sequence was selected from the middle region of FBP2. Peptide sequence YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D-fructose-1,6-bisphosphate 1-phosphohydrolase 2; D-fructose-16-bisphosphate 1-phosphohydrolase 2 EC 3.1.3 EC 3.1.3.11 FBPase 2 fructose-16-bisphosphatase 2 fructose-16-bisphosphatase isozyme 2 hexosediphosphatase MGC142192 muscle fructose-bisphosphatase; FBPase 2; fructose-1,6-bisphosphatase 2; Fructose-1,6-bisphosphatase isozyme 2; hexosediphosphatase; Muscle FBPase; muscle fructose-bisphosphatase
Gene Aliases: FBP2
UniProt ID: (Human) O00757
Entrez Gene ID: (Human) 8789
Molecular Function:
carbohydrate phosphatase
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.