Novus Biologicals
Manufacturer Code:NBP191435
Catalog # NBP191435
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The specific Immunogen is proprietary information. Peptide sequence SKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2810405K02Rik C1orf93 chromosome 1 open reading frame 93 DKFZp547M123 family with sequence similarity 213 member B prostamide/PG F synthase; family with sequence similarity 213, member B; Peroxiredoxin-like 2B; Prostamide/PG F synthase; prostamide/PGF synthase; Prostamide/prostaglandin F synthase; Protein FAM213B
Gene Aliases: C1orf93; FAM213B; PRXL2B
UniProt ID: (Human) B9DI92
Entrez Gene ID: (Human) 127281
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.