Novus Biologicals
Manufacturer Code:NBP15992420UL
Catalog # NBP15992420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FAM134B(family with sequence similarity 134 member B) The peptide sequence was selected from the middle region of FAM134B. Peptide sequence DFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FAM134B protein family with sequence similarity 134 member B FLJ20152 FLJ22155 FLJ22179 HSAN2B JK1; family with sequence similarity 134, member B; protein FAM134B; Reticulophagy receptor 1; Reticulophagy regulator 1
Gene Aliases: FAM134B; JK-1; JK1; RETREG1
UniProt ID: (Human) Q9H6L5
Entrez Gene ID: (Human) 54463
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.