Novus Biologicals
Manufacturer Code:NBP183282
Catalog # NBP183282
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.1.- FAM119A HCA557B Hepatocellular carcinoma-associated antigen 557b hypothetical protein LOC151194 LOC151194 member A methyltransferase like 21A MGC45373; family with sequence similarity 119, member A; heat shock protein 70kDa lysine (K) methyltransferase; Hepatocellular carcinoma-associated antigen 557b; HSPA lysine methyltransferase; HSPA-KMT; Methyltransferase-like protein 21A; Protein N-lysine methyltransferase METTL21A; protein-lysine methyltransferase METTL21A
Gene Aliases: FAM119A; HCA557B; HSPA-KMT; METTL21A
UniProt ID: (Human) Q8WXB1
Entrez Gene ID: (Human) 151194
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.