Novus Biologicals
Manufacturer Code:NBP15983520UL
Catalog # NBP15983520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FAM105A (family with sequence similarity 105 member A) The peptide sequence was selected from the N terminal of FAM105A. Peptide sequence HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: family with sequence similarity 105 member A FLJ11127 FLJ43660 hypothetical protein LOC54491 NET20; family with sequence similarity 105, member A; Inactive ubiquitin thioesterase OTULINL; protein FAM105A
Gene Aliases: FAM105A; NET20; OTULINL
UniProt ID: (Human) Q9NUU6
Entrez Gene ID: (Human) 54491
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.