Novus Biologicals
Manufacturer Code:NBP15967920UL
Catalog # NBP15967920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ALDH3A2(aldehyde dehydrogenase 3 family member A2) The peptide sequence was selected from the middle region of ALDH3A2 (NP_001026976). Peptide sequence DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Aldehyde dehydrogenase 10; Aldehyde dehydrogenase 10 aldehyde dehydrogenase 3 family member A2 Aldehyde dehydrogenase family 3 member A2 ALDH10FLJ20851 EC 1.2.1 EC 1.2.1.3 FALDHDKFZp686E23276 fatty aldehyde dehydrogenase Microsomal aldehyde dehydrogenase SLS; aldehyde dehydrogenase 3 family, member A2; Aldehyde dehydrogenase family 3 member A2; Fatty aldehyde dehydrogenase; Microsomal aldehyde dehydrogenase
Gene Aliases: ALDH10; ALDH3A2; FALDH; SLS
UniProt ID: (Human) P51648
Entrez Gene ID: (Human) 224
Molecular Function:
dehydrogenase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.