Novus Biologicals
Manufacturer Code:NBP191877
Catalog # NBP191877
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CYB5RPlinoleoyl-CoA desaturase (delta-9-desaturase)-like 3 Cytochrome b5-related protein delta-9 fatty acid desaturase delta-9-desaturase EC 1.14.19 EC 1.14.19.- fatty acid desaturase 3 LLCDL3; cytochrome b5-related protein; Delta(13) desaturase; Delta(13) fatty acid desaturase; delta-9 fatty acid desaturase; delta-9-desaturase; Fatty acid desaturase 3; linoleoyl-CoA desaturase (delta-9-desaturase)-like 3
Gene Aliases: CYB5RP; FADS3; LLCDL3
UniProt ID: (Human) Q9Y5Q0
Entrez Gene ID: (Human) 3995
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.