Novus Biologicals
Manufacturer Code:NBP160085
Catalog # NBP160085
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FADS1(fatty acid desaturase 1) The peptide sequence was selected from the C terminal of FADS1. Peptide sequence FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acyl-CoA (8-3)-desaturase; D5D; D5DFLJ90273 Delta(5) desaturase Delta(5) fatty acid desaturase Delta-5 desaturase delta-5 fatty acid desaturase EC 1.14.19 EC 1.14.19.- FADS6 FADSD5LLCDL1 fatty acid desaturase 1 FLJ38956 linoleoyl-CoA desaturase (delta-6-desaturase)-like 1 TU12; delta(5) desaturase; Delta(5) fatty acid desaturase; delta-5 desaturase; delta-5 fatty acid desaturase; Fatty acid desaturase 1; linoleoyl-CoA desaturase (delta-6-desaturase)-like 1
Gene Aliases: D5D; FADS1; FADS6; FADSD5; LLCDL1; TU12
UniProt ID: (Human) O60427
Entrez Gene ID: (Human) 3992
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.