Novus Biologicals
Manufacturer Code:NBP15685620UL
Catalog # NBP15685620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C22ORF28 The peptide sequence was selected from the middle region of C22ORF28. Peptide sequence EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3'-phosphate/5'-hydroxy nucleic acid ligase; ankyrin repeat domain 54; ankyrin repeat domain 54 C22orf28 chromosome 22 open reading frame 28 DJ149A16.6 EC 6.5.1.3 HSPC117 hypothetical protein LOC51493 novel protein HSPC117 RP1-149A16.6; focal adhesion-associated protein; RNA-splicing ligase RtcB homolog; RTCB
Gene Aliases: C22orf28; DJ149A16.6; FAAP; HSPC117; RTCB
UniProt ID: (Human) Q9Y3I0
Entrez Gene ID: (Human) 51493
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.