Novus Biologicals
Manufacturer Code:NBP16272320UL
Catalog # NBP16272320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FAAH2(fatty acid amide hydrolase 2) The peptide sequence was selected form the C terminal of FAAH2. Peptide sequence SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AMDD amidase domain containing Amidase domain-containing protein Anandamide amidohydrolase 2 EC 3.5.1.99 FAAH-2 fatty acid amide hydrolase 2 fatty-acid amide hydrolase 2 FLJ31204 Oleamide hydrolase 2 RP11-479E16.1; amidase domain containing; Amidase domain-containing protein; Anandamide amidohydrolase 2; Fatty-acid amide hydrolase 2; Oleamide hydrolase 2
Gene Aliases: AMDD; FAAH2
UniProt ID: (Human) Q6GMR7
Entrez Gene ID: (Human) 158584
Molecular Function:
hydrolase
ligase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.