Novus Biologicals
Manufacturer Code:NBP16892820UL
Catalog # NBP16892820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to Fa2h (fatty acid 2-hydroxylase) The peptide sequence was selected from the C terminal of Fa2h. Peptide sequence HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FAAHFAXDC1 FAH1 fatty acid 2-hydroxylase Fatty acid alpha-hydroxylase fatty acid hydroxylase domain containing 1 FLJ25287 SCS7 spastic paraplegia 35 (autosomal recessive) SPG35; Fatty acid 2-hydroxylase; Fatty acid alpha-hydroxylase; fatty acid hydroxylase domain containing 1; Fatty acid hydroxylase domain-containing protein 1; spastic paraplegia 35 (autosomal recessive)
Gene Aliases: FA2H; FAAH; FAH1; FAXDC1; SCS7; SPG35
UniProt ID: (Human) Q7L5A8
Entrez Gene ID: (Human) 79152
Molecular Function:
hydroxylase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.