Novus Biologicals
Manufacturer Code:NBP157471
Catalog # NBP157471
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EXOSC6 (exosome component 6) The peptide sequence was selected from the N terminal of Exosome component 6 . Peptide sequence LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EAP4 exosome component 6hMtr3 hMtr3p homolog of yeast mRNA transport regulator 3 Mtr3 (mRNA transport regulator 3)-homolog MTR3mRNA transport regulator 3 homolog Mtr3p p11exosome complex exonuclease MTR3; Exosome complex component MTR3; exosome complex exonuclease MTR3; Exosome component 6; hMtr3; homolog of yeast mRNA transport regulator 3; mRNA transport regulator 3 homolog; Mtr3 (mRNA transport regulator 3)-homolog; p11
Gene Aliases: EAP4; EXOSC6; hMtr3p; MTR3; Mtr3p; p11
UniProt ID: (Human) Q5RKV6
Entrez Gene ID: (Human) 118460
Molecular Function: RNA binding protein exoribonuclease hydrolase nuclease nucleic acid binding nucleotidyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.