Novus Biologicals
Manufacturer Code:NBP15718020UL
Catalog # NBP15718020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EXOSC4 (exosome component 4) The peptide sequence was selected from the N terminal of Exosome component 4 . Peptide sequence SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Exosome complex component RRP41; exosome complex exonuclease RRP41; exosome complex exonuclease RRP41 exosome component 4Rrp41p exosome component Rrp41 FLJ20591 p12ARibosomal RNA-processing protein 41 RRP41A RRP41Ski6p SKI6hRrp41p; Exosome component 4; exosome component Rrp41; p12A; Ribosomal RNA-processing protein 41
Gene Aliases: EXOSC4; hRrp41p; p12A; RRP41; RRP41A; Rrp41p; SKI6; Ski6p
UniProt ID: (Human) Q9NPD3
Entrez Gene ID: (Human) 54512
Molecular Function:
RNA binding protein
exoribonuclease
hydrolase
nuclease
nucleic acid binding
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.