Novus Biologicals
Manufacturer Code:NBP198363
Catalog # NBP198363
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Eph receptor A4. Peptide sequence VISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEID. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.10 EC 2.7.10.1 EK8 EPH receptor A4 EphA4 EPH-like kinase 8 ephrin type-A receptor 4 HEK8 receptor protein-tyrosine kinase HEK8 SEK TYRO1 TYRO1 protein tyrosine kinase Tyrosine-protein kinase receptor SEK Tyrosine-protein kinase TYRO1; EK8; EPH-like kinase 8; Ephrin type-A receptor 4; receptor protein-tyrosine kinase HEK8; TYRO1 protein tyrosine kinase; Tyrosine-protein kinase receptor SEK; Tyrosine-protein kinase TYRO1
Gene Aliases: EPHA4; HEK8; SEK; TYRO1
UniProt ID: (Human) P54764
Entrez Gene ID: (Human) 2043
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.