Novus Biologicals
Manufacturer Code:NBP189972
Catalog # NBP189972
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKER |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Bax-interacting factor 1; Bax-interacting factor 1 Bif-1dJ612B15.2 CGI-61 endophilin-B1 KIAA0491endophilin B1 SH3 domain-containing GRB2-like protein B1 SH3-containing protein SH3GLB1 SH3-domain GRB2-like endophilin B1 SH3-domain GRB2-like endophilin B1; Bif-1; Endophilin-B1; protein phosphatase 1, regulatory subunit 70; SH3 domain-containing GRB2-like protein B1; SH3-containing protein SH3GLB1; SH3-domain GRB2 like endophilin B1; SH3-domain GRB2-like endophilin B1; testicular tissue protein Li 172
Gene Aliases: Bif-1; CGI-61; dJ612B15.2; KIAA0491; PPP1R70; SH3GLB1
UniProt ID: (Human) Q9Y371
Entrez Gene ID: (Human) 51100
Molecular Function:
G-protein modulator
enzyme modulator
guanyl-nucleotide exchange factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.