Novus Biologicals
Manufacturer Code:NBP157209
Catalog # NBP157209
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EXOSC3 (exosome component 3) The peptide sequence was selected from the middle region of EXOSC3. Peptide sequence TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA3J10.7 CGI-102 exosome complex exonuclease RRP40 exosome component 3MGC15120 exosome component Rrp40 hRrp-40 hRrp40p p10Rrp40p Ribosomal RNA-processing protein 40 RP11-3J10.8 RRP40MGC723; Exosome complex component RRP40; exosome complex exonuclease RRP40; Exosome component 3; p10; Ribosomal RNA-processing protein 40
Gene Aliases: bA3J10.7; CGI-102; EXOSC3; hRrp-40; p10; PCH1B; RRP40; Rrp40p
UniProt ID: (Human) Q9NQT5
Entrez Gene ID: (Human) 51010
Molecular Function: RNA binding protein esterase exoribonuclease hydrolase nuclease nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.