Novus Biologicals
Manufacturer Code:NBP157629
Catalog # NBP157629
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EXOC5 (exocyst complex component 5) The peptide sequence was selected from the N terminal of EXOC5)(50ug). Peptide sequence ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Exocyst complex component 5; exocyst complex component 5 Exocyst complex component Sec10 HSEC10 PRO1912 SEC10 (S. cerevisiae)-like 1 SEC10DKFZp666H126 SEC10L1 SEC10-like 1 SEC10-like 1 (S. cerevisiae) SEC10P; Exocyst complex component Sec10; hSec10; SEC10-like 1
Gene Aliases: EXOC5; HSEC10; PRO1912; SEC10; SEC10L1; SEC10P
UniProt ID: (Human) O00471
Entrez Gene ID: (Human) 10640
Molecular Function:
membrane traffic protein
membrane trafficking regulatory protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.