Novus Biologicals
Manufacturer Code:NBP188404
Catalog # NBP188404
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SKTSPVTQQPQQKVLGSRELPPPEDDQLHSSAPRSSWKERILKAKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWERHGTYLQWLF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3'-5' exoribonuclease EXD2; C14orf114 chromosome 14 open reading frame 114 DKFZp781A0133 DKFZp781L15100 EXDL2 exonuclease 3'-5' domain containing 2 exonuclease 3'-5' domain-containing protein 2 exonuclease 3'-5' domain-like 2 Exonuclease 3'-5' domain-like-containing protein 2 FLJ10738; Exonuclease 3'-5' domain-containing protein 2; exonuclease 3'-5' domain-like 2; Exonuclease 3'-5' domain-like-containing protein 2
Gene Aliases: C14orf114; EXD2; EXDL2
UniProt ID: (Human) Q9NVH0
Entrez Gene ID: (Human) 55218
Molecular Function:
nuclease
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.