Novus Biologicals
Manufacturer Code:NBP180694
Catalog # NBP180694
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Ets transcription factor TEL-2b; ETS translocation variant 7; ETS translocation variant 7 ets variant 7 ets variant gene 7 (TEL2 oncogene) TEL-2 TEL2 oncogene TEL2ETS-related protein Tel2 TELBEts transcription factor TEL-2b Tel-related Ets factor transcription factor ets transcription factor ETV7 Transcription factor Tel-2 TREF; ets variant gene 7 (TEL2 oncogene); ETS-related protein Tel2; Tel-related Ets factor; TEL2 oncogene; Transcription factor ETV7; Transcription factor Tel-2
Gene Aliases: ETV7; TEL-2; TEL2; TELB; TREF
UniProt ID: (Human) Q9Y603
Entrez Gene ID: (Human) 51513
Molecular Function: nucleic acid binding signaling molecule transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.