Novus Biologicals
Manufacturer Code:NBP19832920UL
Catalog # NBP19832920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is ESAM - N-terminal region. Peptide sequence VTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2310008D05Rik; 2310008D05Rik endothelial cell adhesion molecule endothelial cell-selective adhesion molecule HUEL (C4orf1)-interacting protein LP4791 protein W117m; Endothelial cell-selective adhesion molecule; HUEL (C4orf1)-interacting protein; LP4791 protein
Gene Aliases: ESAM; UNQ220/PRO246; W117m
UniProt ID: (Human) Q96AP7
Entrez Gene ID: (Human) 90952
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.