Novus Biologicals
Manufacturer Code:NBP174235
Catalog # NBP174235
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for anti-Esrra antibody: synthetic peptide corresponding to a region of Mouse (NP_031979). Immunizing peptide sequence AGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ERR-alpha; ERR1Estrogen receptor-like 1 ERRa ESRL1ERR-alpha estrogen-related receptor alphaERRalpha NR3B1Nuclear receptor subfamily 3 group B member 1 steroid hormone receptor ERR1; Estrogen receptor-like 1; estrogen-related nuclear receptor alpha; Estrogen-related receptor alpha; Nuclear receptor subfamily 3 group B member 1; Steroid hormone receptor ERR1
Gene Aliases: ERR1; ERRa; ERRalpha; ESRL1; ESRRA; NR3B1
UniProt ID: (Human) P11474
Entrez Gene ID: (Human) 2101
Molecular Function:
nuclear hormone receptor
nucleic acid binding
receptor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.