Novus Biologicals
Manufacturer Code:NBP188393
Catalog # NBP188393
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C12orf46 chromosome 12 open reading frame 46 endoplasmic reticulum protein 27 endoplasmic reticulum protein 27 kDa endoplasmic reticulum resident protein 27 ER protein 27 ERp27 FLJ32115 PDIA8 protein disulfide isomerase family A member 8; endoplasmic reticulum protein 27 kDa; Endoplasmic reticulum resident protein 27; ER protein 27; Inactive protein disulfide-isomerase 27; protein disulfide isomerase family A, member 8
Gene Aliases: C12orf46; ERP27; PDIA8; UNQ781/PRO1575
UniProt ID: (Human) Q96DN0
Entrez Gene ID: (Human) 121506
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.