Novus Biologicals
Manufacturer Code:NBP16251320UL
Catalog # NBP16251320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ERMAP(erythroblast membrane-associated protein (Scianna blood group)) The peptide sequence was selected from the middle region of ERMAP. Peptide sequence PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: erythroblast membrane-associated protein (Scianna blood group); erythroblast membrane-associated protein erythroblast membrane-associated protein (RD and SC blood groups) erythroblast membrane-associated protein (Scianna blood group) erythroid membrane-associated protein hERMAP MGC118810 MGC118811 PRO2801 Radin blood group Radin blood group (Rd) Radin blood group antigen RDMGC118812 Scianna blood group Scianna blood group (Sc) Scianna blood group antigen SCMGC118813; Erythroid membrane-associated protein; hERMAP; Radin blood group (Rd); Radin blood group antigen; Scianna blood group (Sc); Scianna blood group antigen
Gene Aliases: BTN5; ERMAP; PRO2801; RD; SC
UniProt ID: (Human) Q96PL5
Entrez Gene ID: (Human) 114625
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.