Novus Biologicals
Manufacturer Code:NBP158322
Catalog # NBP158322
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ERAS(ES cell expressed Ras) The peptide sequence was selected from the middle region of ERAS. Peptide sequence AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: E-Ras; Embryonic stem cell-expressed Ras; Embryonic stem cell-expressed Ras E-Ras ES cell expressed Ras HRAS2MGC126693 HRASPGTPase ERas MGC126691 small GTPase protein E-Ras v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2 v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene; GTPase ERas; small GTPase protein E-Ras; v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2; v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene
Gene Aliases: ERAS; HRAS2; HRASP
UniProt ID: (Human) Q7Z444
Entrez Gene ID: (Human) 3266
Molecular Function:
G-protein
enzyme modulator
small GTPase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.