Novus Biologicals
Manufacturer Code:NBP15661520UL
Catalog # NBP15661520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EPS8L1(EPS8-like 1) The peptide sequence was selected from the middle region of EPS8L1. Peptide sequence LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DRC3EPS8R1 epidermal growth factor receptor kinase substrate 8-like protein 1 Epidermal growth factor receptor pathway substrate 8-related protein 1 EPS8-like 1 EPS8-like protein 1 EPS8-related protein 1 FLJ20258 MGC23164 MGC4642; Epidermal growth factor receptor kinase substrate 8-like protein 1; Epidermal growth factor receptor pathway substrate 8-related protein 1; EPS8-like 1; EPS8-like protein 1; EPS8-related protein 1
Gene Aliases: DRC3; EPS8L1; EPS8R1; PP10566
UniProt ID: (Human) Q8TE68
Entrez Gene ID: (Human) 54869
Molecular Function: transmembrane receptor regulatory/adaptor protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.