Novus Biologicals
Manufacturer Code:NBP15676320UL
Catalog # NBP15676320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EPB41L2(erythrocyte membrane protein band 4.1-like 2) The peptide sequence was selected from the middle region of EPB41L2. Peptide sequence AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4.1G; Band 4.1-like protein 2; band 4.1-like protein 24.1G DKFZp781D1972 DKFZp781H17554.1-G erythrocyte membrane protein band 4.1 like-protein 2 erythrocyte membrane protein band 4.1-like 2 Generally expressed protein 4.1; erythrocyte membrane protein band 4.1 like-protein 2; Erythrocyte membrane protein band 4.1-like 2; Generally expressed protein 4.1
Gene Aliases: 4.1-G; 4.1G; EPB41L2
UniProt ID: (Human) O43491
Entrez Gene ID: (Human) 2037
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.