Novus Biologicals
Manufacturer Code:NBP189372
Catalog # NBP189372
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEGAKEEGGEEVAKAVLE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4.1B; 4.1BFLJ37633 DAL1DAL-1 Differentially expressed in adenocarcinoma of the lung protein 1 erythrocyte membrane protein band 4.1-like 3 KIAA0987band 4.1-like protein 3; Band 4.1-like protein 3; Band 4.1-like protein 3, N-terminally processed; DAL-1; Differentially expressed in adenocarcinoma of the lung protein 1; Erythrocyte membrane protein band 4.1-like 3
Gene Aliases: 4.1B; DAL-1; DAL1; EPB41L3; KIAA0987
UniProt ID: (Human) Q9Y2J2
Entrez Gene ID: (Human) 23136
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.