Novus Biologicals
Manufacturer Code:NBP169313
Catalog # NBP169313
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC29A2(solute carrier family 29 (nucleoside transporters) member 2) The peptide sequence was selected from the C terminal of SLC29A2. Peptide sequence PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 36 kDa nucleolar protein HNP36; Delayed-early response protein 12; Delayed-early response protein 12 DER12Solute carrier family 29 member 2 ENT2 Equilibrative NBMPR-insensitive nucleoside transporter Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleosidetransporter equilibrative nucleoside transporter 2 HNP3636 kDa nucleolar protein HNP36 Hydrophobic nucleolar protein 36 kDa hydrophobic nucleolar protein 36kD Nucleoside transporter ei-type solute carrier family 29 (nucleoside transporters) member 2; Equilibrative NBMPR-insensitive nucleoside transporter; Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter; Equilibrative nucleoside transporter 2; Hydrophobic nucleolar protein, 36 kDa; hydrophobic nucleolar protein, 36kD; Nucleoside transporter, ei-type; solute carrier family 29 (equilibrative nucleoside transporter), member 2; solute carrier family 29 (nucleoside transporters), member 2; Solute carrier family 29 member 2
Gene Aliases: DER12; ENT2; HNP36; SLC29A2
UniProt ID: (Human) Q14542
Entrez Gene ID: (Human) 3177
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.