Novus Biologicals
Manufacturer Code:NBP184838
Catalog # NBP184838
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ENT1es-type equilibrative nucleoside transporter 1 MGC1465 MGC3778 solute carrier family 29 (nucleoside transporters) member 1 Solute carrier family 29 member 1 solute carrier family 29 member 1; Equilibrative NBMPR-sensitive nucleoside transporter; equilibrative nitrobenzylmercaptopurine riboside (NBMPR)-sensitive nucleoside transporter; Equilibrative nitrobenzylmercaptopurine riboside-sensitive nucleoside transporter; Equilibrative nucleoside transporter 1; Nucleoside transporter, es-type; solute carrier family 29 (equilibrative nucleoside transporter), member 1; solute carrier family 29 (nucleoside transporters), member 1; Solute carrier family 29 member 1
Gene Aliases: ENT1; SLC29A1
UniProt ID: (Human) Q99808
Entrez Gene ID: (Human) 2030
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.