Novus Biologicals
Manufacturer Code:NBP15795420UL
Catalog # NBP15795420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ENPP6(ectonucleotide pyrophosphatase/phosphodiesterase 6) The peptide sequence was selected from the middle region of ENPP6. Peptide sequence ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B830047L21Rik; B830047L21Rik EC 3.1 ectonucleotide pyrophosphatase/phosphodiesterase 6 ectonucleotide pyrophosphatase/phosphodiesterase family member 6 E-NPP 6 MGC33971 NPP6 NPP-6; Choline-specific glycerophosphodiester phosphodiesterase; E-NPP 6; Ectonucleotide pyrophosphatase/phosphodiesterase family member 6; glycerophosphocholine cholinephosphodiesterase; Glycerophosphocholine cholinephosphodiesterase ENPP6; GPC-Cpde; NPP-6
Gene Aliases: ENPP6; NPP6; UNQ1889/PRO4334
UniProt ID: (Human) Q6UWR7
Entrez Gene ID: (Human) 133121
Molecular Function: hydrolase nucleotide phosphatase phosphatase pyrophosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.