Novus Biologicals
Manufacturer Code:NBP188928
Catalog # NBP188928
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alkaline phosphodiesterase I; CD203c; CD203c CD203c antigen dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3) dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3) ectonucleotide pyrophosphatase/phosphodiesterase 3 ectonucleotide pyrophosphatase/phosphodiesterase family member 3 E-NPP 3 gp130RB13-6 NPP3 PD-IBETA PDNP3B10 Phosphodiesterase I beta Phosphodiesterase I/nucleotide pyrophosphatase 3 phosphodiesterase-I beta; dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3); dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3); E-NPP 3; Ectonucleotide pyrophosphatase/phosphodiesterase family member 3; gp130RB13-6; NPPase; Nucleotide diphosphatase; Nucleotide pyrophosphatase; PD-Ibeta; Phosphodiesterase I beta; Phosphodiesterase I/nucleotide pyrophosphatase 3; phosphodiesterase-I beta
Gene Aliases: B10; CD203c; ENPP3; NPP3; PD-IBETA; PDNP3
UniProt ID: (Human) O14638
Entrez Gene ID: (Human) 5169
Molecular Function:
hydrolase
nucleotide phosphatase
phosphatase
pyrophosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.