Novus Biologicals
Manufacturer Code:NBP238945
Catalog # NBP238945
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alkaline phosphodiesterase 1; Alkaline phosphodiesterase I; E-NPP 1; ectonucleotide pyrophosphatase/phosphodiesterase 1 E-NPP 1 Ly-41 antigen M6S1NPP1 Membrane component chromosome 6 surface marker 1 membrane component chromosome 6 surface marker 1 NPPSalkaline phosphodiesterase 1 PC1 PC-1 PCA1ARHR2 PDNP1ectonucleotide pyrophosphatase/phosphodiesterase family member 1 Phosphodiesterase I/nucleotide pyrophosphatase 1 plasma-cell membrane glycoprotein 1 Plasma-cell membrane glycoprotein PC-1; Ectonucleotide pyrophosphatase/phosphodiesterase family member 1; Ectonucleotide pyrophosphatase/phosphodiesterase family member 1, secreted form; Ly-41 antigen; Membrane component chromosome 6 surface marker 1; membrane component, chromosome 6, surface marker 1; NPPase; Nucleotide diphosphatase; Nucleotide pyrophosphatase; Phosphodiesterase I/nucleotide pyrophosphatase 1; plasma-cell membrane glycoprotein 1; Plasma-cell membrane glycoprotein PC-1
Gene Aliases: ARHR2; COLED; ENPP1; M6S1; NPP1; NPPS; PC-1; PC1; PCA1; PDNP1
UniProt ID: (Human) P22413
Entrez Gene ID: (Human) 5167
Molecular Function:
hydrolase
nucleotide phosphatase
phosphatase
pyrophosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.