Novus Biologicals
Manufacturer Code:NBP179778
Catalog # NBP179778
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human ENOX2The immunogen for this antibody is ENOX2. (YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE). Peptide sequence YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: APK1 antigen; COVA1 Cytosolic ovarian carcinoma antigen 1APK1 antigen ecto-NOX disulfide-thiol exchanger 2 tNOXAPK1 Tumor-associated hydroquinone oxidase; Cytosolic ovarian carcinoma antigen 1; Ecto-NOX disulfide-thiol exchanger 2; Hydroquinone [NADH] oxidase; Protein disulfide-thiol oxidoreductase; tNOX; Tumor-associated hydroquinone oxidase
Gene Aliases: APK1; COVA1; ENOX2; tNOX
UniProt ID: (Human) Q16206
Entrez Gene ID: (Human) 10495
Molecular Function:
nuclease
nucleic acid binding
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.