Novus Biologicals
Manufacturer Code:NBP213962
Catalog # NBP213962
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYS TEMKEESVKKHQYPDGEVWKK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Antisense RNA to thymidylate synthase; Antisense RNA to thymidylate synthase EC 5.- enolase superfamily member 1 HSRTSBETA rTS rTS beta RTSrTS alpha TYMSASmitochondrial enolase superfamily member 1; L-fuconate dehydratase; Mitochondrial enolase superfamily member 1; rTS
Gene Aliases: ENOSF1; RTS; TYMSAS
UniProt ID: (Human) Q7L5Y1
Entrez Gene ID: (Human) 55556
Molecular Function: dehydratase epimerase/racemase isomerase lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.