Novus Biologicals
Manufacturer Code:NBP15628620UL
Catalog # NBP15628620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EME1(essential meiotic endonuclease 1 homolog 1 (S. pombe)) The peptide sequence was selected from the N terminal of EME1. Peptide sequence MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Crossover junction endonuclease EME1; crossover junction endonuclease EME1 EC 3.1.22 EC 3.1.22.- essential meiotic endonuclease 1 homolog 1 (S. pombe) essential meiotic endonuclease 1 homolog 2 FLJ31364 hMMS4 homolog of yeast EME1 endonuclease MMS4 MMS4 homolog MMS4L SLX2 structure-specific endonuclease subunit homolog A SLX2A; essential meiotic endonuclease 1 homolog 1; essential meiotic endonuclease 1 homolog 2; hMMS4; homolog of yeast EME1 endonuclease; MMS4 homolog; SLX2 structure-specific endonuclease subunit homolog A
Gene Aliases: EME1; MMS4; MMS4L; SLX2A
UniProt ID: (Human) Q96AY2
Entrez Gene ID: (Human) 146956
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.