Novus Biologicals
Manufacturer Code:NBP193926
Catalog # NBP193926
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MAFSDLTSRTVHLYDNWIKDADPRVEDWLLM |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-keto acyl-CoA synthase ELOVL7; Elongation of very long chain fatty acids protein 7; ELOVL FA elongase 7; ELOVL family member 7 elongation of long chain fatty acids ELOVL fatty acid elongase 7; ELOVL family member 7, elongation of long chain fatty acids; ELOVL fatty acid elongase 7; Very long chain 3-ketoacyl-CoA synthase 7; Very long chain 3-oxoacyl-CoA synthase 7; very-long-chain 3-oxoacyl-CoA synthase 7
Gene Aliases: ELOVL7
UniProt ID: (Human) A1L3X0
Entrez Gene ID: (Human) 79993
Molecular Function:
acyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.