Novus Biologicals
Manufacturer Code:NBP233500
Catalog # NBP233500
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-keto acyl-CoA synthase ELOVL5; dJ483K16.1 EC 2.3.1.n8 elongation of very long chain fatty acids protein 5 ELOVL family member 5 elongation of long chain fatty acids (FEN1/Elo2 ELOVL23-keto acyl-CoA synthase ELOVL5 Fatty acid elongase 1 hELO1 HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2 homolog of yeast long chain polyunsaturated fatty acid elongatio SUR4/Elo3-like yeast); Elongation of very long chain fatty acids protein 5; ELOVL FA elongase 5; ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast); ELOVL fatty acid elongase 5; Fatty acid elongase 1; hELO1; homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2; spinocerebellar ataxia 38; Very long chain 3-ketoacyl-CoA synthase 5; Very long chain 3-oxoacyl-CoA synthase 5; very-long-chain 3-oxoacyl-CoA synthase 5
Gene Aliases: dJ483K16.1; ELOVL2; ELOVL5; HELO1; PRO0530; SCA38
UniProt ID: (Human) Q9NYP7
Entrez Gene ID: (Human) 60481
Molecular Function:
acyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.