Novus Biologicals
Manufacturer Code:NBP257039
Catalog # NBP257039
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAHVNRADSPPKEEQGRTILLDSEENSYLLFDDEQFVVKAFRLFHRIPSFGF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D29elaC (E. coli) homolog 1 Deleted in Ma29 EC 3.1.26.11 elaC homolog 1 (E. coli) ElaC homolog protein 1 FLJ59261 Ribonuclease Z 1 RNase Z 1 tRNA 3 endonuclease 1 tRNA 3' processing endoribonuclease tRNA Z (short form) tRNase Z 1 tRNase ZS zinc phosphodiesterase ELAC protein 1; Deleted in Ma29; elaC homolog 1; ElaC homolog protein 1; Ribonuclease Z 1; RNase Z 1; RNaseZ(S); tRNA 3 endonuclease 1; tRNA 3' processing endoribonuclease; tRNA Z (short form); tRNase Z 1; tRNase ZS; Zinc phosphodiesterase ELAC protein 1
Gene Aliases: D29; ELAC1
UniProt ID: (Human) Q9H777
Entrez Gene ID: (Human) 55520
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.